Product Description
Recombinant Human Apolipoprotein C-IV (APOC4) is available at Gentaur for Next week Delivery.
Gene Name: APOC4
Alternative Names : Apolipoprotein C4
Expression Region : 27-127aa
AA Sequence : CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 13.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May participate in lipoprotein metabolism.
Function : May participate in lipoprotein metabolism.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Apolipoprotein C4 family
Tissue Specificity : Expressed by the liver and secreted in plasma.
Paythway :
Uniprot ID : P55056
Euro
British Pound
US Dollar