Recombinant Human Appetite-regulating hormone (GHRL)

Product Description

Recombinant Human Appetite-regulating hormone (GHRL) is available at Gentaur for Next week Delivery.

Gene Name: GHRL

Alternative Names : Growth hormone secretagogue Growth hormone-releasing peptide Motilin-related peptide Protein M46

Expression Region : 1-117aa

AA Sequence : MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Sequence Info : Full Length of BC025791

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation. Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility

Function : Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.; FUNCTION

Involvement in disease :

Subcellular location : Secreted

Protein Families : Motilin family

Tissue Specificity : Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.

Paythway : cAMPsignalingpathway

Uniprot ID : Q9UBU3