Recombinant Human Aquaporin-1 (AQP1), partial

Product Description

Recombinant Human Aquaporin-1 (AQP1), partial is available at Gentaur for Next week Delivery.

Gene Name: AQP1

Alternative Names : Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule

Expression Region : 220-269aa

AA Sequence : GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 32.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Forms a water-specific channel that provides the plasma mbranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Function : Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : MIP/aquaporin (TC 1.A.8) family

Tissue Specificity : Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver.

Paythway :

Uniprot ID : P29972