Recombinant Human B-cell receptor-associated protein 31 (BCAP31), partial

Product Description

Recombinant Human B-cell receptor-associated protein 31 (BCAP31), partial is available at Gentaur for Next week Delivery.

Gene Name: BCAP31

Alternative Names : 6C6-AG tumor-associated antigen;Protein CDMp28

Expression Region : 2-243aa

AA Sequence : SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 54.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Apoptosis

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmbrane proteins. May be involved in CASP8-mediated apoptosis.

Function : Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.

Involvement in disease : Deafness, dystonia, and cerebral hypomyelination (DDCH)

Subcellular location : Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein

Protein Families : BCAP29/BCAP31 family

Tissue Specificity : Ubiquitous. Highly expressed in neurons and discrete endocrine cells.

Paythway : Proteinprocessinginendoplasmicreticulum

Uniprot ID : P51572