Recombinant Human Basigin (BSG), partial

Product Description

Recombinant Human Basigin (BSG), partial is available at Gentaur for Next week Delivery.

Gene Name: BSG

Alternative Names : 5F7Collagenase stimulatory factorExtracellular domain matrix metalloproteinase inducer;EMMPRINLeukocyte activation antigen M6OK blood group antigen;Tumor cell-derived collagenase stimulatory factor;TCSF; CD147

Expression Region : 138-321aa

AA Sequence : EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to the plasma mbrane. Plays pivotal roles in spermatogenesis, bryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Ses to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.

Function : Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8 and SLC16A11 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein, Melanosome

Protein Families :

Tissue Specificity : Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.

Paythway :

Uniprot ID : P35613