Product Description
Recombinant Human Bcl-2-modifying factor (BMF) is available at Gentaur for Next week Delivery.
Gene Name: BMF
Alternative Names :
Expression Region : 1-184aa
AA Sequence : MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
Sequence Info : Full Length of BC069505
Tag Info : N-terminal GST-tagged
Theoretical MW : 47.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in apoptosis. Isoform 1 seems to be the main initiator.
Function : May play a role in apoptosis. Isoform 1 seems to be the main initiator.
Involvement in disease :
Subcellular location :
Protein Families : Bcl-2 family
Tissue Specificity : Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.
Paythway :
Uniprot ID : Q96LC9
 Euro
            
 British Pound
            
 US Dollar