Recombinant Human Bcl-2-modifying factor (BMF)

Product Description

Recombinant Human Bcl-2-modifying factor (BMF) is available at Gentaur for Next week Delivery.

Gene Name: BMF

Alternative Names :

Expression Region : 1-184aa

AA Sequence : MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

Sequence Info : Full Length of BC069505

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in apoptosis. Isoform 1 seems to be the main initiator.

Function : May play a role in apoptosis. Isoform 1 seems to be the main initiator.

Involvement in disease :

Subcellular location :

Protein Families : Bcl-2 family

Tissue Specificity : Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.

Paythway :

Uniprot ID : Q96LC9