Product Description
Recombinant Human Beta-1 adrenergic receptor (ADRB1), partial is available at Gentaur for Next week Delivery.
Gene Name: ADRB1
Alternative Names : Beta-1 adrenoreceptor Short name: Beta-1 adrenoceptor
Expression Region : 378-477aa
AA Sequence : CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
Function : Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein, Early endosome
Protein Families : G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Tissue Specificity :
Paythway : Calciumsignalingpathway
Uniprot ID : P08588
Euro
British Pound
US Dollar