Recombinant Human Beta-1 adrenergic receptor (ADRB1), partial

Product Description

Recombinant Human Beta-1 adrenergic receptor (ADRB1), partial is available at Gentaur for Next week Delivery.

Gene Name: ADRB1

Alternative Names : Beta-1 adrenoreceptor Short name: Beta-1 adrenoceptor

Expression Region : 378-477aa

AA Sequence : CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 12.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Function : Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Early endosome

Protein Families : G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily

Tissue Specificity :

Paythway : Calciumsignalingpathway

Uniprot ID : P08588