Recombinant Human Beta-catenin-interacting protein 1 (CTNNBIP1)

Product Description

Recombinant Human Beta-catenin-interacting protein 1 (CTNNBIP1) is available at Gentaur for Next week Delivery.

Gene Name: CTNNBIP1

Alternative Names : Inhibitor of beta-catenin and Tcf-4

Expression Region : 1-81aa

AA Sequence : MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 36.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.

Function : Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : CTNNBIP1 family

Tissue Specificity :

Paythway : Wntsignalingpathway

Uniprot ID : Q9NSA3