Recombinant Human Beta-defensin 4A (DEFB4A)

Product Description

Recombinant Human Beta-defensin 4A (DEFB4A) is available at Gentaur for Next week Delivery.

Gene Name: DEFB4A

Alternative Names : Beta-defensin 2

Expression Region : 1-64aa

AA Sequence : MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 31.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells

Function : Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells

Involvement in disease :

Subcellular location : Secreted

Protein Families : Beta-defensin family, LAP/TAP subfamily

Tissue Specificity : Expressed in the skin and respiratory tract.

Paythway :

Uniprot ID : O15263