Product Description
Recombinant Human Beta-nerve growth facto r(NGF), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: NGF
Alternative Names : Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
Expression Region : 122-239aa
AA Sequence : SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Sequence Info : Partial
Tag Info : Tag-Free
Theoretical MW : 13.5 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 250 mM NaCl, pH 7.0
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Human ?-Nerve Growth Factor (?-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits ?, ?, and ?; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. ?-NGF is a neurotrophic factor that signals through its receptor ?-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. ?-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that ?-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human ?-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Function : Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI
Involvement in disease : Neuropathy, hereditary sensory and autonomic, 5 (HSAN5)
Subcellular location : Secreted
Protein Families : NGF-beta family
Tissue Specificity :
Paythway : MAPKsignalingpathway
Uniprot ID : P01138
Euro
British Pound
US Dollar