Recombinant Human BH3-interacting domain death agonist (BID)

Product Description

Recombinant Human BH3-interacting domain death agonist (BID) is available at Gentaur for Next week Delivery.

Gene Name: BID

Alternative Names : p22 BID;BID

Expression Region : 1-195aa

AA Sequence : MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Apoptosis

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The major proteolytic product p15 BID allows the release of cytochrome c . Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.1 Publication

Function : The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.

Involvement in disease :

Subcellular location : Cytoplasm, Mitochondrion membrane, Note=When uncleaved, it is predominantly cytoplasmic, SUBCELLULAR LOCATION: BH3-interacting domain death agonist p15: Mitochondrion membrane, Note=Translocates to mitochondria as an integral membrane protein, SUBCELLULAR LOCATION: BH3-interacting domain death agonist p13: Mitochondrion membrane, Note=Associated with the mitochondrial membrane, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion membrane

Protein Families :

Tissue Specificity : Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).

Paythway : p53signalingpathway

Uniprot ID : P55957