Product Description
Recombinant Human BH3-like motif-containing cell death inducer (BLID) is available at Gentaur for Next week Delivery.
Gene Name: BLID
Alternative Names : Breast cancer cell protein 2
Expression Region : 1-108aa
AA Sequence : MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 39 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Function : Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Involvement in disease :
Subcellular location : Cytoplasm, Mitochondrion
Protein Families :
Tissue Specificity : Ubiquitously expressed.
Paythway :
Uniprot ID : Q8IZY5
Euro
British Pound
US Dollar