Recombinant Human Biglycan (BGN)

Product Description

Recombinant Human Biglycan (BGN) is available at Gentaur for Next week Delivery.

Gene Name: BGN

Alternative Names : Bone/cartilage proteoglycan I PG-S1

Expression Region : 38-368aa

AA Sequence : DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 57.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in collagen fiber assembly.

Function : May be involved in collagen fiber assembly.

Involvement in disease : Meester-Loeys syndrome (MRLS); Spondyloepimetaphyseal dysplasia, X-linked (SEMDX)

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily

Tissue Specificity : Found in several connective tissues, especially in articular cartilages.

Paythway :

Uniprot ID : P21810