Product Description
Recombinant Human Bis (5'-nucleosyl)-tetraphosphatase [asymmetrical] (NUDT2) is available at Gentaur for Next week Delivery.
Gene Name: NUDT2
Alternative Names : Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase
Expression Region : 1-147aa
AA Sequence : MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 43.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis.
Function : Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis.
Involvement in disease :
Subcellular location :
Protein Families : Nudix hydrolase family
Tissue Specificity :
Paythway :
Uniprot ID : P50583
Euro
British Pound
US Dollar