Recombinant Human Blood group Rh (D) polypeptide (RHD), partial

Product Description

Recombinant Human Blood group Rh (D) polypeptide (RHD), partial is available at Gentaur for Next week Delivery.

Gene Name: RHD

Alternative Names : RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D

Expression Region : 388-417aa

AA Sequence : LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-GST-tagged

Theoretical MW : 33.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Function : May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : Ammonium transporter (TC 2.A.49) family, Rh subfamily

Tissue Specificity : Restricted to tissues or cell lines expressing erythroid characters.

Paythway :

Uniprot ID : Q02161