Recombinant Human Bone marrow proteoglycan (PRG2), partial

Product Description

Recombinant Human Bone marrow proteoglycan (PRG2), partial is available at Gentaur for Next week Delivery.

Gene Name: PRG2

Alternative Names : Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein

Expression Region : 106-222aa

AA Sequence : TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.

Function : Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.

Involvement in disease :

Subcellular location : Bone marrow proteoglycan: Secreted, Note=The proform is secreted, SUBCELLULAR LOCATION: Eosinophil granule major basic protein: Cytoplasmic vesicle, secretory vesicle

Protein Families :

Tissue Specificity : High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.

Paythway :

Uniprot ID : P13727