Recombinant Human Bone morphogenetic protein 3 (BMP3)

Product Description

Recombinant Human Bone morphogenetic protein 3 (BMP3) is available at Gentaur for Next week Delivery.

Gene Name: BMP3

Alternative Names : Bone morphogenetic protein 3A;BMP-3AOsteogenin

Expression Region : 363-472aa

AA Sequence : QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 16.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Function : Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Involvement in disease :

Subcellular location : Secreted

Protein Families : TGF-beta family

Tissue Specificity : Expressed in adult and fetal cartilage.

Paythway :

Uniprot ID : P12645