Euro
British Pound
US Dollar
Product Description
Recombinant Human Bone morphogenetic protein 6 (BMP6), partial is available at Gentaur for Next week Delivery.
Gene Name: BMP6
Alternative Names : VG-1-related protein;VG-1-R;VGR-1
Expression Region : 382-513aa
AA Sequence : QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 18.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Developmental Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Induces cartilage and bone formation.
Function : Induces cartilage and bone formation.
Involvement in disease :
Subcellular location : Secreted
Protein Families : TGF-beta family
Tissue Specificity :
Paythway : Hipposignalingpathway
Uniprot ID : P22004
