Product Description
Recombinant Human Bone morphogenetic protein 7 (BMP7) is available at Gentaur for Next week Delivery.
Gene Name: BMP7
Alternative Names : Osteogenic protein 1;OP-1INN: Eptotermin alfa
Expression Region : 293-431aa
AA Sequence : STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 19.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Developmental Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Function : Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Involvement in disease :
Subcellular location : Secreted
Protein Families : TGF-beta family
Tissue Specificity : Expressed in the kidney and bladder. Lower levels seen in the brain.
Paythway : Hipposignalingpathway
Uniprot ID : P18075
Euro
British Pound
US Dollar