Recombinant Human BPI fold-containing family A member 2 (BPIFA2)

Product Description

Recombinant Human BPI fold-containing family A member 2 (BPIFA2) is available at Gentaur for Next week Delivery.

Gene Name: BPIFA2

Alternative Names : Parotid secretory protein

Expression Region : 14-249aa

AA Sequence : ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 25.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has strong antibacterial activity against P. aeruginosa.

Function : Has strong antibacterial activity against P. aeruginosa.

Involvement in disease :

Subcellular location : Secreted

Protein Families : BPI/LBP/Plunc superfamily, Plunc family

Tissue Specificity : Detected in submandibular gland. Secreted into saliva.

Paythway :

Uniprot ID : Q96DR5