Product Description
Recombinant Human Butyrophilin subfamily 2 member A2 (BTN2A2), partial is available at Gentaur for Next week Delivery.
Gene Name: BTN2A2
Alternative Names :
Expression Region : 33-262aa
AA Sequence : QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS
Sequence Info : Partial of Isoform 2
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 41.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.
Function : Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity : Highly expressed in brain, bone marrow, small intestine, muscle, spleen and pancreas. Moderate expression was seen in lung, liver and kidney.
Paythway :
Uniprot ID : Q8WVV5
Euro
British Pound
US Dollar