Product Description
Recombinant Human C-C motif chemokine 19 (CCL19) is available at Gentaur for Next week Delivery.
Gene Name: CCL19
Alternative Names : Beta-chemokine exodus-3CK beta-11Epstein-Barr virus-induced molecule 1 ligand chemokine;EBI1 ligand chemokine;ELCMacrophage inflammatory protein 3 beta;MIP-3-beta;Small-inducible cytokine A19
Expression Region : 22-98aa
AA Sequence : GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 35.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chokine receptor CCR7. Recombinant CCL19 shows potent chotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Function : May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine beta (chemokine CC) family
Tissue Specificity : Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Paythway : Chemokinesignalingpathway
Uniprot ID : Q99731
Euro
British Pound
US Dollar