Recombinant Human C-C motif chemokine 21 (CCL21)

Product Description

Recombinant Human C-C motif chemokine 21 (CCL21) is available at Gentaur for Next week Delivery.

Gene Name: CCL21

Alternative Names : 6Ckine;Beta-chemokine exodus-2;Secondary lymphoid-tissue chemokine;SLC;Small-inducible cytokine A21

Expression Region : 24-134aa

AA Sequence : SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibits hopoiesis and stimulates chotaxis. Chotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Function : Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine beta (chemokine CC) family

Tissue Specificity : Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.

Paythway : Chemokinesignalingpathway

Uniprot ID : O00585