Recombinant Human C-type lectin domain family 4 member D (CLEC4D), partial

Product Description

Recombinant Human C-type lectin domain family 4 member D (CLEC4D), partial is available at Gentaur for Next week Delivery.

Gene Name: CLEC4D

Alternative Names : C-type lectin superfamily member -type lectin-like receptor 6;CLEC-6

Expression Region : 39-215aa

AA Sequence : CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.

Function : Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families :

Tissue Specificity : Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma.

Paythway :

Uniprot ID : Q8WXI8