Recombinant Human C-X-C motif chemokine 10(CXCL10) (Active)

Product Description

Recombinant Human C-X-C motif chemokine 10(CXCL10) (Active) is available at Gentaur for Next week Delivery.

Gene Name: CXCL10

Alternative Names : C-X-C Motif Chemokine 10; 10 kDa Interferon Gamma-Induced Protein; Gamma-IP10; IP-10; Small-Inducible Cytokine B10; CXCL10; INP10; SCYB10

Expression Region : 22-98aa

AA Sequence : VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 8.6 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06 ?g/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-?. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity.

Function : Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity :

Paythway : Chemokinesignalingpathway

Uniprot ID : P02778