Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), partial

Product Description

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), partial is available at Gentaur for Next week Delivery.

Gene Name: CXCL13

Alternative Names : AngieB cell-attracting chemokine 1;BCA-1B lymphocyte chemoattractantCXC chemokine BLCSmall-inducible cytokine B13

Expression Region : 23-95aa

AA Sequence : VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 12.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Function : Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity : Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.

Paythway : Chemokinesignalingpathway

Uniprot ID : O43927