Product Description
Recombinant Human C-X-C motif chemokine 3 (CXCL3) is available at Gentaur for Next week Delivery.
Gene Name: CXCL3
Alternative Names : GRO-gamma(1-73)Growth-regulated protein gamma;GRO-gammaMacrophage inflammatory protein 2-beta;MIP2-beta
Expression Region : 310-157aa
AA Sequence : ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 11.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Ligand for CXCR2 . Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chotactic activity for neutrophilic granulocytes.1 Publication
Function : Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine alpha (chemokine CxC) family
Tissue Specificity :
Paythway : Chemokinesignalingpathway
Uniprot ID : P19876
Euro
British Pound
US Dollar