Product Description
Recombinant Human C-X-C motif chemokine 3 (CXCL3) (Active) is available at Gentaur for Next week Delivery.
Gene Name: CXCL3
Alternative Names : C-X-C Motif Chemokine 3; GRO-Gamma (1-73); Growth-Regulated Protein Gamma; GRO-Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2-Beta; GRO-Gamma (5-73); CXCL3; GRO3; GROG; SCYB3
Expression Region : 310-157aa
AA Sequence : ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 10.1 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 80 ng/mL.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Function : Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine alpha (chemokine CxC) family
Tissue Specificity :
Paythway : Chemokinesignalingpathway
Uniprot ID : P19876
Euro
British Pound
US Dollar