Recombinant Human Calcitonin gene-related peptide 2 (CALCB)

Product Description

Recombinant Human Calcitonin gene-related peptide 2 (CALCB) is available at Gentaur for Next week Delivery.

Gene Name: CALCB

Alternative Names : Beta-type CGRP

Expression Region : 1-127aa

AA Sequence : MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Function : CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Calcitonin family

Tissue Specificity :

Paythway :

Uniprot ID : P10092