Product Description
Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) is available at Gentaur for Next week Delivery.
Gene Name: CAMK2N1
Alternative Names : CaMKII inhibitory protein alpha (CaMKIIN-alpha)
Expression Region : 1-78aa
AA Sequence : MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-Trx-tagged
Theoretical MW : 25.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Potent and specific inhibitor of CaM-kinase II.
Function : Potent and specific inhibitor of CaM-kinase II (CAMK2).
Involvement in disease :
Subcellular location : Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density
Protein Families : CAMK2N family
Tissue Specificity : Widely expressed. Nor detected in skeletal muscle.
Paythway :
Uniprot ID : Q7Z7J9
Euro
British Pound
US Dollar