Recombinant Human Carbonic anhydrase 1 (CA1) (Active)

Product Description

Recombinant Human Carbonic anhydrase 1 (CA1) (Active) is available at Gentaur for Next week Delivery.

Gene Name: CA1

Alternative Names : Carbonic Anhydrase 1; Carbonate Dehydratase I; Carbonic Anhydrase B; CAB; Carbonic Anhydrase I; CA-I; CA1

Expression Region : 2-261aa

AA Sequence : ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 29.93 kDa

Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The esterase activity is determined to be greater than 500 pmol/min/ug

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Carbonic Anhydrase 1 (CA1) is a cytosolic enzyme, belonging to the alpha-carbonic anhydrase family. It is highly expressed in erythrocytes and acts as an early marker for erythroid differentiation. Carbonic anhydrase 1 plays a improtant role in many biological processes such as calcification, cellular respiration, bone resorption, acid-base balance. It is activated by imidazole, histamine, L-adrenaline, L- and D-histidine, and L- and D-phenylalanine. At the same time, It is inhibited by sulfonamide derivatives and coumarins. In addition, CA1 is a zinc metalloenzyme that has reversible hydration of carbon dioxide. It can hydrate cyanamide to urea.

Function : Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Alpha-carbonic anhydrase family

Tissue Specificity :

Paythway :

Uniprot ID : P00915