Euro
British Pound
US Dollar
Product Description
Recombinant Human Carbonic anhydrase 13 (CA13) (Active) is available at Gentaur for Next week Delivery.
Gene Name: CA13
Alternative Names : Carbonic Anhydrase 13; Carbonate Dehydratase XIII; Carbonic Anhydrase XIII; CA-XIII; CA13
Expression Region : 1-262aa
AA Sequence : MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Sequence Info : Full Length
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 30.51 kDa
Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The esterase activity is determined to be greater than 1000 pmol/min/ug
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Carbonic Anhydrase 13 (CA13) belongs to the carbonic anhydrase family which can catalyzes the reversible hydration recation of carbon dioxide. Carbonic anhydrases participate in many biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA13 is a cytosolic enzyme and is widely expressed in human, such as thymus, small intestine, spleen, prostate, ovary, colon and testis, indicating that it may play a key role in several organs. CA13 is inhibited by acetazolamide.
Function : Reversible hydration of carbon dioxide.
Involvement in disease :
Subcellular location :
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity : Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
Paythway :
Uniprot ID : Q8N1Q1
