Euro
British Pound
US Dollar
Product Description
Recombinant Human Carbonic anhydrase 2 (CA2) is available at Gentaur for Next week Delivery.
Gene Name: CA2
Alternative Names : Carbonate dehydratase II;Carbonic anhydrase C;CAC;Carbonic anhydrase II;CA-II
Expression Region : 2-260aa
AA Sequence : SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Sequence Info : Full Length of BC011949
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 45.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Essential for bone resorption and osteoclast differentiation . Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.3 Publications
Function : Essential for bone resorption and osteoclast differentiation (By similarity). Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.
Involvement in disease : Osteopetrosis, autosomal recessive 3 (OPTB3)
Subcellular location : Cytoplasm, Cell membrane
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity :
Paythway :
Uniprot ID : P00918
