Product Description
Recombinant Human Carbonic anhydrase 4 (CA4), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: CA4
Alternative Names : Carbonic Anhydrase 4; Carbonate Dehydratase IV; Carbonic Anhydrase IV; CA-IV; CA4
Expression Region : 19-283aa
AA Sequence : AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Sequence Info : Partial
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 31.43 kDa
Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.5
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The esterase activity is determined to be greater than 500 pmol/min/ug
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Carbonic Anhydrase 4 (CA4) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Carbonic anhydrase 4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Carbonic anhydrase 4 may stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It may have a role in inherited renal abnormalities of bicarbonate transport. Furthermore, Carbonic anhydrase 4 is essential for acid overload removal from the retina and retina epithelium and acid release in the choriocapillaris.
Function : Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.
Involvement in disease : Retinitis pigmentosa 17 (RP17)
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity : Expressed in the endothelium of the choriocapillaris in eyes (at protein level). Not expressed in the retinal epithelium at detectable levels.
Paythway :
Uniprot ID : P22748
 Euro
            
 British Pound
            
 US Dollar