Product Description
Recombinant Human Carbonic anhydrase 5B, mitochondrial (CA5B) (Active) is available at Gentaur for Next week Delivery.
Gene Name: CA5B
Alternative Names : Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B
Expression Region : 34-317aa
AA Sequence : CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Sequence Info : Full Length of Mature Protein
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 33.77 kDa
Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The esterase activity is determined to be greater than 1000 pmol/min/ug
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Carbonic Anhydrase 5B (CA5B) is a member of alpha-carbonic anhydrase family (CAs) that catalyze the reversible hydration of carbon dioxide. CAs is associated with many biological processes, including calcification, respiration, bone resorption, acid-base balance and the formation of aqueous humor. CA5B is highly expressed in heart, pancreas, kidney, placenta, lung, and skeletal muscle, but it is restricted to the liver. CA5B is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA-VA. CA5B is inhibited by coumarins, sulfonamide derivatives such as acetazolamide (AZA), saccharin, and Foscarnet.
Function : Reversible hydration of carbon dioxide.
Involvement in disease :
Subcellular location : Mitochondrion
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity : Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver.
Paythway :
Uniprot ID : Q9Y2D0
Euro
British Pound
US Dollar