Recombinant Human Carbonic anhydrase-related protein (CA8)

Product Description

Recombinant Human Carbonic anhydrase-related protein (CA8) is available at Gentaur for Next week Delivery.

Gene Name: CA8

Alternative Names : Carbonic anhydrase VIII

Expression Region : 1-290aa

AA Sequence : MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 60 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Does not have a carbonic anhydrase catalytic activity.

Function : Does not have a carbonic anhydrase catalytic activity.

Involvement in disease : Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)

Subcellular location :

Protein Families : Alpha-carbonic anhydrase family

Tissue Specificity :

Paythway :

Uniprot ID : P35219