Product Description
Recombinant Human Carbonic anhydrase-related protein (CA8) is available at Gentaur for Next week Delivery.
Gene Name: CA8
Alternative Names : Carbonic anhydrase VIII
Expression Region : 1-290aa
AA Sequence : MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 60 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Does not have a carbonic anhydrase catalytic activity.
Function : Does not have a carbonic anhydrase catalytic activity.
Involvement in disease : Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Subcellular location :
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity :
Paythway :
Uniprot ID : P35219
Euro
British Pound
US Dollar