Product Description
Recombinant Human Carbonic anhydrase-related protein (CA8), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: CA8
Alternative Names : Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS
Expression Region : 2-290aa
AA Sequence : ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Sequence Info : Partial
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 34.04 kDa
Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The esterase activity is determined to be greater than 100 pmol/min/ug
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Carbonic Anhydrase 8 (CA8) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Because CA8 has some sequence similarity with other known carbonic anhydrase genes, it was firstly called as CA-related protein. Nevertheless, CA8 does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3), which is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation.
Function : Does not have a carbonic anhydrase catalytic activity.
Involvement in disease : Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Subcellular location :
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity :
Paythway :
Uniprot ID : P35219
Euro
British Pound
US Dollar