Euro
British Pound
US Dollar
Product Description
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial is available at Gentaur for Next week Delivery.
Gene Name: CEACAM4
Alternative Names : Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236
Expression Region : 36-155aa
AA Sequence : FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Function : Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Immunoglobulin superfamily, CEA family
Tissue Specificity : Granulocytes.
Paythway :
Uniprot ID : O75871
