Product Description
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) is available at Gentaur for Next week Delivery.
Gene Name: CEACAM7
Alternative Names : Carcinoembryonic antigen CGM2
Expression Region : 36-242aa
AA Sequence : TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 39.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Tags & Cell Markers
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor
Protein Families : Immunoglobulin superfamily, CEA family
Tissue Specificity : Strongly down-regulated in colonic adenocarcinomas.
Paythway :
Uniprot ID : Q14002
Euro
British Pound
US Dollar