Recombinant Human Cardiac phospholamban (P26678)

Product Description

Recombinant Human Cardiac phospholamban (P26678) is available at Gentaur for Next week Delivery.

Gene Name: P26678

Alternative Names :

Expression Region : 1-52aa

AA Sequence : MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 33.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation

Function : Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Involvement in disease : Cardiomyopathy, dilated 1P (CMD1P); Cardiomyopathy, familial hypertrophic 18 (CMH18)

Subcellular location : Endoplasmic reticulum membrane, Single-pass membrane protein, Sarcoplasmic reticulum membrane, Single-pass membrane protein, Mitochondrion membrane, Single-pass membrane protein, Membrane, Single-pass membrane protein

Protein Families : Phospholamban family

Tissue Specificity : Heart muscle (at protein level).

Paythway : Calciumsignalingpathway

Uniprot ID : P26678