Product Description
Recombinant Human Caspase-1 (CASP1), partial is available at Gentaur for Next week Delivery.
Gene Name: CASP1
Alternative Names : Interleukin-1 beta convertase;IL-1BCInterleukin-1 beta-converting enzyme;ICE;IL-1 beta-converting enzymep45
Expression Region : 120-269aa
AA Sequence : NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 43.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Apoptosis
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Can also promote apoptosis.
Function : Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Peptidase C14A family
Tissue Specificity : Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.
Paythway : LipidsandInflammation inAtherogenesis
Uniprot ID : P29466
Euro
British Pound
US Dollar