Recombinant Human Caspase-7 (CASP7), partial

Product Description

Recombinant Human Caspase-7 (CASP7), partial is available at Gentaur for Next week Delivery.

Gene Name: CASP7

Alternative Names : Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3;ICE-LAP3

Expression Region : 207-303aa

AA Sequence : ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Apoptosis

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Function : Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Peptidase C14A family

Tissue Specificity : Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Paythway : TNFsignalingpathway

Uniprot ID : P55210