Recombinant Human Catechol O-methyltransferase (COMT), partial

Product Description

Recombinant Human Catechol O-methyltransferase (COMT), partial is available at Gentaur for Next week Delivery.

Gene Name: COMT

Alternative Names :

Expression Region : 52-271aa

AA Sequence : GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.

Function : Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.

Involvement in disease : Schizophrenia (SCZD)

Subcellular location : Isoform Soluble: Cytoplasm, SUBCELLULAR LOCATION: Isoform Membrane-bound: Cell membrane, Single-pass type II membrane protein, Extracellular side

Protein Families : Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family

Tissue Specificity : Brain, liver, placenta, lymphocytes and erythrocytes.

Paythway :

Uniprot ID : P21964