Recombinant Human Cathelicidin antimicrobial peptide (CAMP)

Product Description

Recombinant Human Cathelicidin antimicrobial peptide (CAMP) is available at Gentaur for Next week Delivery.

Gene Name: CAMP

Alternative Names : 18KDA cationic antimicrobial protein

Expression Region : 132-170aa

AA Sequence : FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 24.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Function : Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Cathelicidin family

Tissue Specificity : Expressed in bone marrow and testis and neutrophils.

Paythway : NOD-likereceptorsignalingpathway

Uniprot ID : P49913