Recombinant Human Cathepsin E (CTSE) (Active)

Product Description

Recombinant Human Cathepsin E (CTSE) (Active) is available at Gentaur for Next week Delivery.

Gene Name: CTSE

Alternative Names : Cathepsin E; CTSE

Expression Region : 20-396aa

AA Sequence : SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 41.78 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM MES, 150 mM NaCl, pH 5.5

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : Specific activity as determined by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 is greater than 1500 pmol/min/ug

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cathepsin E (CTSE) is a gastric aspartyl protease that functions as a disulfide-linked homodimer. It is a member of the Peptidase C1 family, and has a specificity similar to that of Pepsin A and Cathepsin D. CTSE is localized to the endoplasmic reticulum and Golgi apparatus, while the mature enzyme is localized to the endosome. It is expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. CTSE is an intracellular proteinase that have a role in immune function, activation-induced lymphocyte depletion in the thymus, neuronal degeneration and glial cell activation in the brain. Futhermore, it probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation.

Function : May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.

Involvement in disease :

Subcellular location : Endosome

Protein Families : Peptidase A1 family

Tissue Specificity : Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.

Paythway :

Uniprot ID : P14091