Recombinant Human Cathepsin F protein (CTSF), partial

Product Description

Recombinant Human Cathepsin F protein (CTSF), partial is available at Gentaur for Next week Delivery.

Gene Name: CTSF

Alternative Names :

Expression Region : 273-484aa

AA Sequence : PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Function : Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Involvement in disease : Ceroid lipofuscinosis, neuronal, 13 (CLN13)

Subcellular location : Lysosome

Protein Families : Peptidase C1 family

Tissue Specificity : High expression levels in heart, skeletal muscle, brain, testis and ovary; moderate levels in prostate, placenta, liver and colon; and no detectable expression in peripheral leukocytes and thymus.

Paythway : Apoptosis

Uniprot ID : Q9UBX1