Recombinant Human Cathepsin O (CTSO)

Product Description

Recombinant Human Cathepsin O (CTSO) is available at Gentaur for Next week Delivery.

Gene Name: CTSO

Alternative Names : CTSO1

Expression Region : 108-321aa

AA Sequence : LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 28.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Function : Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Involvement in disease :

Subcellular location : Lysosome

Protein Families : Peptidase C1 family

Tissue Specificity : Expressed in all tissues examined. High levels seen in the ovary, kidney and placenta while low levels seen in thymus and skeletal muscle.

Paythway : Apoptosis

Uniprot ID : P43234