Recombinant Human Caveolin-3 (CAV3)

Product Description

Recombinant Human Caveolin-3 (CAV3) is available at Gentaur for Next week Delivery.

Gene Name: CAV3

Alternative Names : M-caveolin

Expression Region : 1-151aa

AA Sequence : MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 44.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress.

Function : May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress (By similarity). Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae

Involvement in disease : Limb-girdle muscular dystrophy 1C (LGMD1C); HyperCKmia (HYPCK); Rippling muscle disease 2 (RMD2); Cardiomyopathy, familial hypertrophic (CMH); Long QT syndrome 9 (LQT9); Sudden infant death syndrome (SIDS); Myopathy, distal, Tateyama type (MPDT)

Subcellular location : Golgi apparatus membrane, Peripheral membrane protein, Cell membrane, Peripheral membrane protein, Membrane, caveola, Peripheral membrane protein, Cell membrane, sarcolemma

Protein Families : Caveolin family

Tissue Specificity : Expressed predominantly in muscle.

Paythway : Focaladhesion

Uniprot ID : P56539