Product Description
Recombinant Human CD320 antigen (CD320), partial is available at Gentaur for Next week Delivery.
Gene Name: CD320
Alternative Names : 8D6 antigenFDC-signaling molecule 8D6;FDC-SM-8D6Transcobalamin receptor;TCblR;; CD320
Expression Region : 36-231aa
AA Sequence : SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 47.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.
Function : Receptor for transcobalamin saturated with cobalamin (TCbl)
Involvement in disease : Methylmalonic aciduria, transient, due to transcobalamin receptor defect (MMATC)
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity : Detected in the germinal center (GC) of lymphoid follicles (at protein level) (PubMed:11418631). Expressed abundantly on follicular dendritic cells (FDCs) (PubMed:10727470).
Paythway :
Uniprot ID : Q9NPF0
Euro
British Pound
US Dollar