Recombinant Human CD48 antigen (CD48)

Product Description

Recombinant Human CD48 antigen (CD48) is available at Gentaur for Next week Delivery.

Gene Name: CD48

Alternative Names : B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 SLAM family member 2 Short name: SLAMF2 Signaling lymphocytic activation molecule 2 TCT.1 CD_antigen: CD48 BCM1, BLAST1

Expression Region : 27-220aa

AA Sequence : QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal FC-tagged

Theoretical MW : 48.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.

Function : Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor

Protein Families :

Tissue Specificity :

Paythway : Naturalkillercellmediatedcytotoxicity

Uniprot ID : P09326